PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr034487.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family CO-like
Protein Properties Length: 456aa    MW: 49862.7 Da    PI: 7.114
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr034487.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.71e-074678436
     zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                   C++++ ++++  C+d ++ lC++C  + H++
  Pbr034487.1 46 LLCDKCNAQPAIVRCTDEKMSLCQSCDHWNHNN 78
                 57*****************************87 PP

2CCT61.52.7e-21399442144
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                  R++a++RYkeK+ktR F K+irY+sRKa+A++R+RvKGrF k+ 
  Pbr034487.1 399 RDKAKMRYKEKKKTRTFGKQIRYASRKARADTRKRVKGRFIKAG 442
                  899*************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501198.589147IPR000315B-box-type zinc finger
SMARTSM003363.2E-7147IPR000315B-box-type zinc finger
CDDcd000210.00672347No hitNo description
PfamPF062031.9E-16399441IPR010402CCT domain
PROSITE profilePS5101714.882399441IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MEPLCVFCGV ERAVVYCRSD MARLCFHCDG CVHSANGLSR RHPRSLLCDK CNAQPAIVRC  60
TDEKMSLCQS CDHWNHNNNS INGTTTASAV GGMGGHRTHA LTCYTGCPSL SQFSRIWSSF  120
LEGSSSSGGN FESSNWESLG SAVVAINQDQ TCISNNGLEG RDSNERPFGL VVTAGNLNGG  180
SSLDQSCGRK FDPWLASSST LIPSNPICMP YGKDQTPFLP QESSLPKGYN NFKDLAIQDS  240
NVLCDGLNID DVPMNFENPD GIFCPRVPSR YQFEDGEMDC LLMEKNIPVT ESNGHNENAA  300
QASSSGQRDC VAFRSSCGSD TVLPGMNGSA NCLLMNPTCS RSINLGFPTT QQVHPSMSHS  360
LSSISRECNP DYQDRGLSPV FLAGEPWEST LEASSPQARD KAKMRYKEKK KTRTFGKQIR  420
YASRKARADT RKRVKGRFIK AGEEYDYDPL VTRSF*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009342260.10.0PREDICTED: putative zinc finger protein CONSTANS-LIKE 11
TrEMBLM5XFT80.0M5XFT8_PRUPE; Uncharacterized protein
STRINGGLYMA12G32221.11e-155(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70521923
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21880.12e-74B-box type zinc finger protein with CCT domain